PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10689s0126.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 763aa    MW: 83548.2 Da    PI: 5.7516
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10689s0126.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-1963118156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t+ q++eLe++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R+++k
  Bostr.10689s0126.1.p  63 KKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRELSLEPLQVKFWFQNKRTQMK 118
                           688999***********************************************998 PP

2START213.76.7e-672624811206
                           HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                 START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                           ela +a++elv++a+ ++p+Wv+     e++n++e+ ++f+++ +      + ea+r+s+vv+m++ +l e+l+d++ qW+  +     
  Bostr.10689s0126.1.p 262 ELAVAAMEELVRMAQTGDPLWVSNDnsvEILNEEEYFRTFPRGIGpkpigLRLEASRESTVVIMNHINLIEILMDVN-QWSSVFCgivs 349
                           57899*****************998889**************999********************************.******99999 PP

                           EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                 START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           +a tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++++++g w++vdvS+ds ++ p    + R++++pSg+li++++n
  Bostr.10689s0126.1.p 350 RALTLEVLSTGvagnydGALQVMTAEFQVPSPLVPtRENYFVRYCKKHSDGIWAVVDVSLDSLRPSP----ITRSRRRPSGCLIQELQN 434
                           *****************************************************************99....7***************** PP

                           CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           g+skvtwveh+++++r++h+++++lv++gla+gak+wvatl+rqce+
  Bostr.10689s0126.1.p 435 GYSKVTWVEHTEVDDRSVHSMYKPLVNTGLAFGAKRWVATLDRQCER 481
                           *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2244118IPR009057Homeodomain-like
SuperFamilySSF466891.59E-1852120IPR009057Homeodomain-like
PROSITE profilePS5007117.00660120IPR001356Homeobox domain
SMARTSM003891.5E-1761124IPR001356Homeobox domain
PfamPF000467.5E-1763118IPR001356Homeobox domain
CDDcd000862.64E-1863121No hitNo description
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PROSITE profilePS5084845.97253484IPR002913START domain
SuperFamilySSF559613.71E-35255483No hitNo description
CDDcd088753.19E-123257480No hitNo description
SMARTSM002341.6E-78262481IPR002913START domain
PfamPF018524.1E-56263481IPR002913START domain
Gene3DG3DSA:3.30.530.206.8E-6360480IPR023393START-like domain
SuperFamilySSF559619.34E-23502680No hitNo description
SuperFamilySSF559619.34E-23715754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048825Biological Processcotyledon development
GO:0090627Biological Processplant epidermal cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MYHPNMFESH HHMFDMTLKN SENDLGITGS REEDFETKSG AEVTMENPLE EELQDPNQRP  60
NKKKRYHRHT QRQIQELESF FKECPHPDDK QRKELSRELS LEPLQVKFWF QNKRTQMKAQ  120
HERHENQILK SENDKFRAEN NRYKDALSNA TCPNCGGPAA IGEMSFDEQH LRIENARLRE  180
EIDRISAIAA KYVGKPLLAN SSPFPQLTSS HHIPSRSLNL EVGNFGNNSN SQAGFVGEMY  240
GTSDILRSVS IPSEADKTMI VELAVAAMEE LVRMAQTGDP LWVSNDNSVE ILNEEEYFRT  300
FPRGIGPKPI GLRLEASRES TVVIMNHINL IEILMDVNQW SSVFCGIVSR ALTLEVLSTG  360
VAGNYDGALQ VMTAEFQVPS PLVPTRENYF VRYCKKHSDG IWAVVDVSLD SLRPSPITRS  420
RRRPSGCLIQ ELQNGYSKVT WVEHTEVDDR SVHSMYKPLV NTGLAFGAKR WVATLDRQCE  480
RLASSMASNI PAGDLSVITS AEGRKSMLKL AERMVMSFCS GVGASTAHAW TTLSATGSDD  540
VRVMTRKSMD DPGRPPGIVL SAATSFWIPV APKRVFDFLR DENSRSEWDI LSNGGLVQEM  600
AHIANGRDPG NSVSLLRVNS GNSGQTNMLI LQESCTDSSG SYVIYAPVDI MAMNVVLSGG  660
DPDYVALLPS GFAILPDGSA RDGGGSASAG AGAGAEGGRE GNNLEVVTTT GNSGGSLLTV  720
AFQILVDSVP TAKLSLGSVA TVNSLIKCTV ERIKAAVACD GA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299700.0AK229970.1 Arabidopsis thaliana mRNA for L1 specific homeobox gene ATML1/ovule-specific homeobox protein A20, complete cds, clone: RAFL22-43-B20.
GenBankAY0911040.0AY091104.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds.
GenBankAY1504910.0AY150491.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010439429.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
RefseqXP_010439430.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLR0GNC90.0R0GNC9_9BRAS; Uncharacterized protein
STRINGAT4G21750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein